Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG10 Peptide - middle region

ALG10 Peptide - middle region

Product Specifications

Product Name Alternative

DIE2, FLJ14751, KCR1

UniProt

Q5BKT4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG10 Rabbit Polyclonal Antibody (orb586527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116223

Preservative

Lyophilized powder

AA Sequence

AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBN Antibody
MBS8587866-01 0.1 mg

NBN Antibody

Sign In for Pricing
View Details
NBN Antibody
MBS8587866-02 0.1 mL (AF405L)

NBN Antibody

Sign In for Pricing
View Details
NBN Antibody
MBS8587866-03 0.1 mL (AF405S)

NBN Antibody

Sign In for Pricing
View Details
NBN Antibody
MBS8587866-04 0.1 mL (AF610)

NBN Antibody

Sign In for Pricing
View Details
NBN Antibody
MBS8587866-05 0.1 mL (AF635)

NBN Antibody

Sign In for Pricing
View Details
NBN Antibody
MBS8587866-06 0.1 mL (APC)

NBN Antibody

Sign In for Pricing
View Details