Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMTS14 Peptide - N-terminal region

ADAMTS14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ32820

UniProt

Q5T4G1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAMTS14 Rabbit Polyclonal Antibody (orb586340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631894

Preservative

Lyophilized powder

AA Sequence

REAVQQEWAEPDGDLHNEAFGLGDLPNLLGLVGDQLGDTERKRRHAKPGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTA succinimidyl ester
12607-AAT 1 mg

NTA succinimidyl ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS806228 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Human TMEM129 activation kit by CRISPRa
GA114203 1 Kit

Human TMEM129 activation kit by CRISPRa

Sign In for Pricing
View Details
DYRK1A Rabbit Polyclonal Antibody
AP06728PU-N 100 µg

DYRK1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NKIRAS2 (NM_001144927) Human Over-expression Lysate
LY428581 100 µg

NKIRAS2 (NM_001144927) Human Over-expression Lysate

Sign In for Pricing
View Details
Butachlor-d13 (Major)
TRC-B689927-1MG 1 mg

Butachlor-d13 (Major)

Sign In for Pricing
View Details