Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMTS14 Peptide - N-terminal region

ADAMTS14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ32820

UniProt

Q5T4G1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAMTS14 Rabbit Polyclonal Antibody (orb586340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631894

Preservative

Lyophilized powder

AA Sequence

REAVQQEWAEPDGDLHNEAFGLGDLPNLLGLVGDQLGDTERKRRHAKPGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2M1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]
TA503019AM 100 µL

AP2M1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]

Sign In for Pricing
View Details
POLE Human Gene Knockout Kit (CRISPR)
KN224742LP 1 Kit

POLE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADRM1 (NM_175573) Human Recombinant Protein
TP305671M 100 µg

ADRM1 (NM_175573) Human Recombinant Protein

Sign In for Pricing
View Details
IP10 Antibody
KC-7874-01 50 μL

IP10 Antibody

Sign In for Pricing
View Details
IP10 Antibody
KC-7874-02 100 µL

IP10 Antibody

Sign In for Pricing
View Details
IP10 Antibody
KC-7874-03 1 mL

IP10 Antibody

Sign In for Pricing
View Details