Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf3 Peptide - C-terminal region

Atf3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRG-21

UniProt

Q60765

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atf3 Rabbit Polyclonal Antibody (orb573749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031524

Preservative

Lyophilized powder

AA Sequence

ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A4]
TA503032AM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A4]

Sign In for Pricing
View Details
LIM Kinase 1 (LIMK1) Rabbit Polyclonal Antibody
AP20386PU-N 100 µg

LIM Kinase 1 (LIMK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SAMD14 activation kit by CRISPRa
GA116382 1 Kit

Human SAMD14 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl (5E,8Z,11Z,14Z,17Z)-Icosa-5,8,11,14,17-pentaenoate
TRC-E236940-25MG 25 mg

Ethyl (5E,8Z,11Z,14Z,17Z)-Icosa-5,8,11,14,17-pentaenoate

Sign In for Pricing
View Details
RBX1 Recombinant Rabbit Monoclonal Antibody [PSH07-01]
HA722779 100 µL

RBX1 Recombinant Rabbit Monoclonal Antibody [PSH07-01]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS807252 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details