Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLNK Peptide - C-terminal region

CLNK Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC35197, MIST

UniProt

Q7Z7G1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLNK Rabbit Polyclonal Antibody (orb326530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443196

Preservative

Lyophilized powder

AA Sequence

SRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVKIRFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD156c Polyclonal Antibody
orb1411085 100 µL

CD156c Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Prostaglandin D2 receptor ELISA Kit
MBS2886869-01 48 Well

Bovine Prostaglandin D2 receptor ELISA Kit

Sign In for Pricing
View Details
Bovine Prostaglandin D2 receptor ELISA Kit
MBS2886869-02 96 Well

Bovine Prostaglandin D2 receptor ELISA Kit

Sign In for Pricing
View Details
Bovine Prostaglandin D2 receptor ELISA Kit
MBS2886869-03 5x 96 Well

Bovine Prostaglandin D2 receptor ELISA Kit

Sign In for Pricing
View Details
Bovine Prostaglandin D2 receptor ELISA Kit
MBS2886869-04 10x 96 Well

Bovine Prostaglandin D2 receptor ELISA Kit

Sign In for Pricing
View Details
AZ12799734
BA9161-50 50 mg

AZ12799734

Sign In for Pricing
View Details