Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATCAY Peptide - C-terminal region

ATCAY Peptide - C-terminal region

Product Specifications

Product Name Alternative

BNIP-H, CLAC, KIAA1872

UniProt

Q86WG3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATCAY Rabbit Polyclonal Antibody (orb326375) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149053

Preservative

Lyophilized powder

AA Sequence

LQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH2 Polyclonal Antibody
MBS2575409-01 0.06 mL

ALKBH2 Polyclonal Antibody

Sign In for Pricing
View Details
ALKBH2 Polyclonal Antibody
MBS2575409-02 0.12 mL

ALKBH2 Polyclonal Antibody

Sign In for Pricing
View Details
ALKBH2 Polyclonal Antibody
MBS2575409-03 0.2 mL

ALKBH2 Polyclonal Antibody

Sign In for Pricing
View Details
ALKBH2 Polyclonal Antibody
MBS2575409-04 5x 0.2 mL

ALKBH2 Polyclonal Antibody

Sign In for Pricing
View Details
WDR43 shRNA (m) Lentiviral Particles
sc-155287-V 200 µL

WDR43 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Proteasome 19S S5A Rabbit Polyclonal Antibody (PE-Cy5.5)
orb881889 100 µL

Proteasome 19S S5A Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details