Ap1g1 Peptide - middle region
Ap1g1 Peptide - middle region
Product Specifications
Product Name Alternative
AA409002, AU041323, AW551707, Adtg, D8Ertd374e
UniProt
Q8CBB7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ap1g1 Rabbit Polyclonal Antibody (orb581497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033807
Preservative
Lyophilized powder
AA Sequence
TPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFL
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3537903 1.0 µg DNA
Armc3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
MBS717364-01 0.01 mg
Recombinant human 80 kDa MCM3-associated protein
Sign In for Pricing
View Details MBS717364-02 0.05 mg
Recombinant human 80 kDa MCM3-associated protein
Sign In for Pricing
View Details MBS717364-03 0.2 mg
Recombinant human 80 kDa MCM3-associated protein
Sign In for Pricing
View Details