Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap1g1 Peptide - middle region

Ap1g1 Peptide - middle region

Product Specifications

Product Name Alternative

AA409002, AU041323, AW551707, Adtg, D8Ertd374e

UniProt

Q8CBB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ap1g1 Rabbit Polyclonal Antibody (orb581497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033807

Preservative

Lyophilized powder

AA Sequence

TPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFL

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGI3 Polyclonal Antibody, Cy5 Conjugated
bs-11879R-Cy5-TR 20 µL

LGI3 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse MMP13 Protein, His Tag
32-17829-100 100 µg

Recombinant Mouse MMP13 Protein, His Tag

Sign In for Pricing
View Details
ELISA Kit For MAU2 chromatid cohesion factor homolog
E7586h 96 Tests

ELISA Kit For MAU2 chromatid cohesion factor homolog

Sign In for Pricing
View Details
Galntl1 sgRNA CRISPR Lentivector set (Rat)
K6469601 3x 1.0 µg

Galntl1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
PGRMC1 CRISPR/Cas9 KO Plasmid (m)
sc-424690 20 µg

PGRMC1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Human PARP4 (Poly ADP Ribose Polymerase 4) ELISA Kit
EK243062 96 Well

Human PARP4 (Poly ADP Ribose Polymerase 4) ELISA Kit

Sign In for Pricing
View Details