Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS1R2 Peptide - C-terminal region

TAS1R2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR71, T1R2, TR2

UniProt

Q8TE23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS1R2 Rabbit Polyclonal Antibody (orb586204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689418

Preservative

Lyophilized powder

AA Sequence

ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig 60 kDa heat shock protein, mitochondrial (HSPD1) ELISA Kit
GTR10348142 96 Well

Guinea Pig 60 kDa heat shock protein, mitochondrial (HSPD1) ELISA Kit

Sign In for Pricing
View Details
AKT2, CT (RAC-beta Serine/Threonine-protein Kinase, RAC-PK-beta, Protein Kinase Akt-2, Protein Kinase B, beta, PKB beta) (Biotin) discontinued
A1125-26K-Biotin 200 µL

AKT2, CT (RAC-beta Serine/Threonine-protein Kinase, RAC-PK-beta, Protein Kinase Akt-2, Protein Kinase B, beta, PKB beta) (Biotin) discontinued

Sign In for Pricing
View Details
Platelet-activating Factor acetylhydrolase (PLA2G7) Bovine ELISA Kit
F9480 96 Tests

Platelet-activating Factor acetylhydrolase (PLA2G7) Bovine ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhesus Macaque CD79B (C-6His)
C05C-50ug 50 µg

Recombinant Rhesus Macaque CD79B (C-6His)

Sign In for Pricing
View Details
PICK1 Polyclonal Antibody
MBS9133609-01 0.02 mL

PICK1 Polyclonal Antibody

Sign In for Pricing
View Details
PICK1 Polyclonal Antibody
MBS9133609-02 0.1 mL

PICK1 Polyclonal Antibody

Sign In for Pricing
View Details