Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WHAMM Peptide - C-terminal region

WHAMM Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1971, WHDC1

UniProt

Q8TF30

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WHAMM Rabbit Polyclonal Antibody (orb326586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073904

Preservative

Lyophilized powder

AA Sequence

SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pongo abelii Protein cornichon homolog 4 (CNIH4)
orb2932270-01 20 µg

Recombinant Pongo abelii Protein cornichon homolog 4 (CNIH4)

Sign In for Pricing
View Details
Recombinant Pongo abelii Protein cornichon homolog 4 (CNIH4)
orb2932270-02 100 µg

Recombinant Pongo abelii Protein cornichon homolog 4 (CNIH4)

Sign In for Pricing
View Details
Mouse Monoclonal IL-12 Antibody (1-1A4) [DyLight 350]
NBP2-50440UV 0.1 mL

Mouse Monoclonal IL-12 Antibody (1-1A4) [DyLight 350]

Sign In for Pricing
View Details
RYBP, NT (RYBP, DEDAF, YEAF1, RING1 and YY1-binding protein, Apoptin-associating protein 1, Death effector domain-associated factor, YY1 and E4TF1-associated factor 1) (AP)
MBS6344568-01 0.2 mL

RYBP, NT (RYBP, DEDAF, YEAF1, RING1 and YY1-binding protein, Apoptin-associating protein 1, Death effector domain-associated factor, YY1 and E4TF1-associated factor 1) (AP)

Sign In for Pricing
View Details
RYBP, NT (RYBP, DEDAF, YEAF1, RING1 and YY1-binding protein, Apoptin-associating protein 1, Death effector domain-associated factor, YY1 and E4TF1-associated factor 1) (AP)
MBS6344568-02 5x 0.2 mL

RYBP, NT (RYBP, DEDAF, YEAF1, RING1 and YY1-binding protein, Apoptin-associating protein 1, Death effector domain-associated factor, YY1 and E4TF1-associated factor 1) (AP)

Sign In for Pricing
View Details
MEPE CRISPR Activation Plasmid (h2)
sc-403162-ACT-2 20 µg

MEPE CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details