Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD3L1 Peptide - C-terminal region

MBD3L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MBD3L, MGC138263, MGC138269

UniProt

Q8WWY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBD3L1 Rabbit Polyclonal Antibody (orb586415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660209

Preservative

Lyophilized powder

AA Sequence

CKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1S1 Antibody
F43688-0.08ML 0.08 mL

AKT1S1 Antibody

Sign In for Pricing
View Details
Thifluzamide
TRC-T344705-1G 1 g

Thifluzamide

Sign In for Pricing
View Details
Recombinant Human Interleukin-4/IL-4 Protein
PKSH032650-01 20 µg

Recombinant Human Interleukin-4/IL-4 Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-4/IL-4 Protein
PKSH032650-02 100 µg

Recombinant Human Interleukin-4/IL-4 Protein

Sign In for Pricing
View Details
Tissue Genomic DNA, Esophagus
CD563416 5 µg

Tissue Genomic DNA, Esophagus

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), 0.2mg/mL
BNUB2054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), 0.2mg/mL

Sign In for Pricing
View Details