Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD3L1 Peptide - C-terminal region

MBD3L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MBD3L, MGC138263, MGC138269

UniProt

Q8WWY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBD3L1 Rabbit Polyclonal Antibody (orb586415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660209

Preservative

Lyophilized powder

AA Sequence

CKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human APOM Protein (Fc Tag)
PKSH030622 50 µg

Recombinant Human APOM Protein (Fc Tag)

Sign In for Pricing
View Details
2-Ethoxyacetyl Chloride
TRC-E890930-5G 5 g

2-Ethoxyacetyl Chloride

Sign In for Pricing
View Details
7-Benzyloxy-2-(2,2-diphenyl-1,3-benzodioxol-5-yl)-5-hydroxy-H-1-benzopyran-4-one
TRC-B285610-10MG 10 mg

7-Benzyloxy-2-(2,2-diphenyl-1,3-benzodioxol-5-yl)-5-hydroxy-H-1-benzopyran-4-one

Sign In for Pricing
View Details
Breast cancer suppressor candidate 1 (VWA5A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E10]
TA501636AM 100 µL

Breast cancer suppressor candidate 1 (VWA5A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E10]

Sign In for Pricing
View Details
ARSB Mouse Monoclonal Antibody [Clone ID: OTI4G7]
CF812949 100 µg

ARSB Mouse Monoclonal Antibody [Clone ID: OTI4G7]

Sign In for Pricing
View Details
Recombinant CYP11B2 Antibody
RC-6837-01 50 μL

Recombinant CYP11B2 Antibody

Sign In for Pricing
View Details