TOP1MT Peptide - C-terminal region
TOP1MT Peptide - C-terminal region
Product Specifications
UniProt
Q969P6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TOP1MT Rabbit Polyclonal Antibody (orb331347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_443195
Preservative
Lyophilized powder
AA Sequence
KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PC101055-01 100 mg
2- (4-Chloro-3- (trifluoromethoxy) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
Sign In for Pricing
View Details PC101055-02 250 mg
2- (4-Chloro-3- (trifluoromethoxy) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
Sign In for Pricing
View Details PC101055-03 1 g
2- (4-Chloro-3- (trifluoromethoxy) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
Sign In for Pricing
View Details PC101055-04 5 g
2- (4-Chloro-3- (trifluoromethoxy) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
Sign In for Pricing
View Details 
245862-FITC 100 µL
EXOC7 (Exocyst Complex Component 7, 2-5-3p, DKFZp686J04253, EX070, EXO70, EXOC1, Exo70p, FLJ40965, FLJ46415, YJL085W) (FITC)
Sign In for Pricing
View Details