Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOP1MT Peptide - C-terminal region

TOP1MT Peptide - C-terminal region

Product Specifications

UniProt

Q969P6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOP1MT Rabbit Polyclonal Antibody (orb331347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443195

Preservative

Lyophilized powder

AA Sequence

KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM4 Antibody
OACA08960-50UL 50 µL

TPM4 Antibody

Sign In for Pricing
View Details
Anti-BRD1 (SAA2120) (Mouse, Monoclonal, IgG2a)
A132677 100 µL

Anti-BRD1 (SAA2120) (Mouse, Monoclonal, IgG2a)

Sign In for Pricing
View Details
GLUT9 (SLC2A9) (NM_001001290) Human Tagged ORF Clone
RC202647 10 µg

GLUT9 (SLC2A9) (NM_001001290) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tropomyosin antibody
10R-7906 0.1 mg

Tropomyosin antibody

Sign In for Pricing
View Details
TCF7L1 Antibody
orb380139 100 µL

TCF7L1 Antibody

Sign In for Pricing
View Details
Layilin (LAYN) Antibody
abx343709-01 20 µL

Layilin (LAYN) Antibody

Sign In for Pricing
View Details