Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCLN Peptide - C-terminal region

NCLN Peptide - C-terminal region

Product Specifications

Product Name Alternative

NET59

UniProt

Q969V3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCLN Rabbit Polyclonal Antibody (orb586445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064555

Preservative

Lyophilized powder

AA Sequence

DKDSTFLSTLEHHLSRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin 2 alpha Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-8561R-BF555-TR 20 µL

Laminin 2 alpha Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Lentiviral human KIAA1755 sgRNA gene knockout kit - Lentiviral human KIAA1755 sgRNA gene knockout kit (100)
GTR15366502 1 Vial

Lentiviral human KIAA1755 sgRNA gene knockout kit - Lentiviral human KIAA1755 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Human Putative protein FAM106C (FAM106CP)
MBS1227108-01 0.02 mg (E-Coli)

Recombinant Human Putative protein FAM106C (FAM106CP)

Sign In for Pricing
View Details
Recombinant Human Putative protein FAM106C (FAM106CP)
MBS1227108-02 0.1 mg (E-Coli)

Recombinant Human Putative protein FAM106C (FAM106CP)

Sign In for Pricing
View Details
Recombinant Human Putative protein FAM106C (FAM106CP)
MBS1227108-03 0.02 mg (Yeast)

Recombinant Human Putative protein FAM106C (FAM106CP)

Sign In for Pricing
View Details
Recombinant Human Putative protein FAM106C (FAM106CP)
MBS1227108-04 0.1 mg (Yeast)

Recombinant Human Putative protein FAM106C (FAM106CP)

Sign In for Pricing
View Details