Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCLN Peptide - C-terminal region

NCLN Peptide - C-terminal region

Product Specifications

Product Name Alternative

NET59

UniProt

Q969V3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCLN Rabbit Polyclonal Antibody (orb586445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064555

Preservative

Lyophilized powder

AA Sequence

DKDSTFLSTLEHHLSRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to PER3
E10-30684T 100 µL

Mouse Monoclonal Antibody to PER3

Sign In for Pricing
View Details
Nap1l4 (NM_008672) Mouse Tagged Lenti ORF Clone
MR212438L3 10 µg

Nap1l4 (NM_008672) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Aiolos/IKZF3 Alexa Fluor 405 Antibody (Clone 914821)
FAB8625V-100UG 100 µg

Human Aiolos/IKZF3 Alexa Fluor 405 Antibody (Clone 914821)

Sign In for Pricing
View Details
DNPEP Rabbit Polyclonal Antibody (BF350)
orb2460659 100 µL

DNPEP Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
IL-22, human recombinant
4601-1000 1 mg

IL-22, human recombinant

Sign In for Pricing
View Details
GLP-2 (006-02)
sc-57169 100 µg/mL

GLP-2 (006-02)

Sign In for Pricing
View Details