Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYLPF Peptide - C-terminal region

MYLPF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp779C0757, HUMMLC2B, MGC13450, MRLC2, MYL11

UniProt

Q96A32

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYLPF Rabbit Polyclonal Antibody (orb586444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037424

Preservative

Lyophilized powder

AA Sequence

LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (POMC) Guinea Pig Polyclonal Antibody
TA364380 50 µL

ACTH (POMC) Guinea Pig Polyclonal Antibody

Sign In for Pricing
View Details
ADCY9 Human Gene Knockout Kit (CRISPR)
KN215977 1 Kit

ADCY9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DBeQ
SIH-334-5MG 5 mg

DBeQ

Sign In for Pricing
View Details
Recombinant Human TPL2/MAP3K8/MEKK8 Protein (GST Tag)
PKSH030380 50 µg

Recombinant Human TPL2/MAP3K8/MEKK8 Protein (GST Tag)

Sign In for Pricing
View Details
KLK9 Antibody
KC-38292-01 50 μL

KLK9 Antibody

Sign In for Pricing
View Details
KLK9 Antibody
KC-38292-02 100 µL

KLK9 Antibody

Sign In for Pricing
View Details