Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYLPF Peptide - C-terminal region

MYLPF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp779C0757, HUMMLC2B, MGC13450, MRLC2, MYL11

UniProt

Q96A32

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYLPF Rabbit Polyclonal Antibody (orb586444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037424

Preservative

Lyophilized powder

AA Sequence

LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRASP2 Polyclonal Antibody
E-AB-52667-01 20 µL

GPRASP2 Polyclonal Antibody

Sign In for Pricing
View Details
GPRASP2 Polyclonal Antibody
E-AB-52667-02 60 µL

GPRASP2 Polyclonal Antibody

Sign In for Pricing
View Details
GPRASP2 Polyclonal Antibody
E-AB-52667-03 120 µL

GPRASP2 Polyclonal Antibody

Sign In for Pricing
View Details
GPRASP2 Polyclonal Antibody
E-AB-52667-04 200 µL

GPRASP2 Polyclonal Antibody

Sign In for Pricing
View Details
13-cis-Retinal 95%
TRC-R239900-5MG 5 mg

13-cis-Retinal 95%

Sign In for Pricing
View Details
Neral
TRC-N382910-100MG 100 mg

Neral

Sign In for Pricing
View Details