Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERL2 Peptide - C-terminal region

DERL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-101, F-LAN-1, F-LANa, FLANa

UniProt

Q96Q80

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DERL2 Rabbit Polyclonal Antibody (orb586378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057125

Preservative

Lyophilized powder

AA Sequence

DVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA2 (NM_002488) Human Over-expression Lysate
LC419296 20 µg

NDUFA2 (NM_002488) Human Over-expression Lysate

Sign In for Pricing
View Details
RBPMS Antibody
KC-2815-01 50 μL

RBPMS Antibody

Sign In for Pricing
View Details
RBPMS Antibody
KC-2815-02 100 µL

RBPMS Antibody

Sign In for Pricing
View Details
RBPMS Antibody
KC-2815-03 1 mL

RBPMS Antibody

Sign In for Pricing
View Details
3-tert-Butylthio-2-carboxypyridine
TRC-B693860-500MG 500 mg

3-tert-Butylthio-2-carboxypyridine

Sign In for Pricing
View Details
Human C18orf56 (TYMSOS) activation kit by CRISPRa
GA118592 1 Kit

Human C18orf56 (TYMSOS) activation kit by CRISPRa

Sign In for Pricing
View Details