Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FYCO1 Peptide - N-terminal region

FYCO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp779K1152, FLJ13335, MGC126517, MGC126519, RUFY3, ZFYVE7

UniProt

Q9BQS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FYCO1 Rabbit Polyclonal Antibody (orb586436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078789

Preservative

Lyophilized powder

AA Sequence

PLAQELEATRDSLDKKNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1+JNK2+JNK3 Recombinant Rabbit Monoclonal Antibody [SA43-06]
ET1601-28 100 µL

JNK1+JNK2+JNK3 Recombinant Rabbit Monoclonal Antibody [SA43-06]

Sign In for Pricing
View Details
Human Glucosidase Alpha, Acid (GaA) ELISA Kit
RD-GaA-Hu-01 96 Tests

Human Glucosidase Alpha, Acid (GaA) ELISA Kit

Sign In for Pricing
View Details
Human Glucosidase Alpha, Acid (GaA) ELISA Kit
RD-GaA-Hu-02 48 Tests

Human Glucosidase Alpha, Acid (GaA) ELISA Kit

Sign In for Pricing
View Details
FITC Conjugated Goat Affinity Purified Antibody to Swine IgG
FAF-471-1 1 mL

FITC Conjugated Goat Affinity Purified Antibody to Swine IgG

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody [Clone ID: PR484]
AM32853PU-T 20 µg

Progesterone Receptor (PGR) Mouse Monoclonal Antibody [Clone ID: PR484]

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF17/BCMA Protein (Fc Tag)
PKSM041264-01 10 µg

Recombinant Mouse TNFRSF17/BCMA Protein (Fc Tag)

Sign In for Pricing
View Details