Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTDSP1 Peptide - N-terminal region

CTDSP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NLIIF, SCP1, NIF3, NLI-IF

UniProt

Q9GZU7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTDSP1 Rabbit Polyclonal Antibody (orb331304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067021

Preservative

Lyophilized powder

AA Sequence

KQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mme AAV siRNA Pooled Vector
30226166 1.0 µg

Mme AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Fibrillin 2 (Fibrillin-2, FBN2, Congenital Contractural Arachnodactyly, CCA, DA9) (APC)
F4195-11C-APC 100 µL

Fibrillin 2 (Fibrillin-2, FBN2, Congenital Contractural Arachnodactyly, CCA, DA9) (APC)

Sign In for Pricing
View Details
Anti-RHOBTB3 (L365) Antibody
A10214-1 100 µL

Anti-RHOBTB3 (L365) Antibody

Sign In for Pricing
View Details
Holmium Oxide 99.9% Extrapure
01362 00005 5 g

Holmium Oxide 99.9% Extrapure

Sign In for Pricing
View Details
AQP4 Recombinant Protein
OPCA02594-20UG 20 µg

AQP4 Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details