Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6C Peptide - C-terminal region

RAB6C Peptide - C-terminal region

Product Specifications

Product Name Alternative

WTH3

UniProt

Q9H0N0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB6C Rabbit Polyclonal Antibody (orb584701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115520

Preservative

Lyophilized powder

AA Sequence

YNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Kit Recombinant Rabbit monoclonal Antibody
IRS013 100 µL

C-Kit Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Inactive ubiquitin carboxyl terminal hydrolase 50 (USP50) (NM_203494) Human Over-expression Lysate
LC404246 20 µg

Inactive ubiquitin carboxyl terminal hydrolase 50 (USP50) (NM_203494) Human Over-expression Lysate

Sign In for Pricing
View Details
Atp6v0a4 Mouse Gene Knockout Kit (CRISPR)
KN501809 1 Kit

Atp6v0a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse TF Antibody Pair Set
E-KAB-0576 50 µL & 100 µg

Mouse TF Antibody Pair Set

Sign In for Pricing
View Details
CD59 (NM_000611) Human Over-expression Lysate
LC424608 20 µg

CD59 (NM_000611) Human Over-expression Lysate

Sign In for Pricing
View Details
Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein
TP720491M 50 µg

Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein

Sign In for Pricing
View Details