Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6C Peptide - C-terminal region

RAB6C Peptide - C-terminal region

Product Specifications

Product Name Alternative

WTH3

UniProt

Q9H0N0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB6C Rabbit Polyclonal Antibody (orb584701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115520

Preservative

Lyophilized powder

AA Sequence

YNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD3 Antibody
KC-34197-01 50 μL

SETD3 Antibody

Sign In for Pricing
View Details
SETD3 Antibody
KC-34197-02 100 µL

SETD3 Antibody

Sign In for Pricing
View Details
SETD3 Antibody
KC-34197-03 1 mL

SETD3 Antibody

Sign In for Pricing
View Details
SIRT3 Recombinant Rabbit Monoclonal Antibody [PSH05-22]
HA722251 100 µL

SIRT3 Recombinant Rabbit Monoclonal Antibody [PSH05-22]

Sign In for Pricing
View Details
FCN3 (C-term) Rabbit Polyclonal Antibody
AP51643PU-N 400 µL

FCN3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSH beta (TSHB) (NM_000549) Human Over-expression Lysate
LY424650 100 µg

TSH beta (TSHB) (NM_000549) Human Over-expression Lysate

Sign In for Pricing
View Details