MOB1A Peptide - middle region
MOB1A Peptide - middle region
Product Specifications
Product Name Alternative
C2orf6, FLJ10788, FLJ11595, MATS1, MOB1, MOBK1B, Mob4B, MOBKL1B
UniProt
Q9H8S9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MOB1A Rabbit Polyclonal Antibody (orb586321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060691
Preservative
Lyophilized powder
AA Sequence
EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal TRAIL/TNFSF10 Antibody (B-T24) [Janelia Fluor 669]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP3-14605JF669 0.1 mL
Mouse Monoclonal TRAIL/TNFSF10 Antibody (B-T24) [Janelia Fluor 669]
Sign In for Pricing
View Details 
bs-13248R-BF405 100 µL
G protein alpha 16 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details 