MOB1A Peptide - middle region
MOB1A Peptide - middle region
Product Specifications
Product Name Alternative
C2orf6, FLJ10788, FLJ11595, MATS1, MOB1, MOBK1B, Mob4B, MOBKL1B
UniProt
Q9H8S9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MOB1A Rabbit Polyclonal Antibody (orb586321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060691
Preservative
Lyophilized powder
AA Sequence
EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MSH2 (DNA Mismatch Repair Marker) Recombinant Rabbit Monoclonal Antibody [Clone MSH2/6549R]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
MBS4382103-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
MSH2 (DNA Mismatch Repair Marker) Recombinant Rabbit Monoclonal Antibody [Clone MSH2/6549R]
Sign In for Pricing
View Details MBS4382103-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
MSH2 (DNA Mismatch Repair Marker) Recombinant Rabbit Monoclonal Antibody [Clone MSH2/6549R]
Sign In for Pricing
View Details MBS4382103-03 0.1 mg (Without BSA & Azide at 1mg/mL)
MSH2 (DNA Mismatch Repair Marker) Recombinant Rabbit Monoclonal Antibody [Clone MSH2/6549R]
Sign In for Pricing
View Details MBS4382103-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)
MSH2 (DNA Mismatch Repair Marker) Recombinant Rabbit Monoclonal Antibody [Clone MSH2/6549R]
Sign In for Pricing
View Details MBS4382103-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)
MSH2 (DNA Mismatch Repair Marker) Recombinant Rabbit Monoclonal Antibody [Clone MSH2/6549R]
Sign In for Pricing
View Details 