Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2B3 Peptide - middle region

EIF2B3 Peptide - middle region

Product Specifications

Product Name Alternative

EIF-2B, EIF2Bgamma

UniProt

Q9NR50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2B3 Rabbit Polyclonal Antibody (orb586470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065098

Preservative

Lyophilized powder

AA Sequence

ENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf72 siRNA (Human)
orb1850149-01 15 nmol

C3orf72 siRNA (Human)

Sign In for Pricing
View Details
C3orf72 siRNA (Human)
orb1850149-02 30 nmol

C3orf72 siRNA (Human)

Sign In for Pricing
View Details
(±) -Huperzine A
T13469-01 5 mg

(±) -Huperzine A

Sign In for Pricing
View Details
(±) -Huperzine A
T13469-02 1 mL - 10 mM (in DMSO)

(±) -Huperzine A

Sign In for Pricing
View Details
(±) -Huperzine A
T13469-03 10 mg

(±) -Huperzine A

Sign In for Pricing
View Details
(±) -Huperzine A
T13469-04 25 mg

(±) -Huperzine A

Sign In for Pricing
View Details