Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2B3 Peptide - middle region

EIF2B3 Peptide - middle region

Product Specifications

Product Name Alternative

EIF-2B, EIF2Bgamma

UniProt

Q9NR50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2B3 Rabbit Polyclonal Antibody (orb586470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065098

Preservative

Lyophilized powder

AA Sequence

ENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hccs Pre-designed siRNA Set B
SI206130B 1 Each

Rat Hccs Pre-designed siRNA Set B

Sign In for Pricing
View Details
ALG2 polyclonal antibody
orb647105-01 50 μL

ALG2 polyclonal antibody

Sign In for Pricing
View Details
ALG2 polyclonal antibody
orb647105-02 100 µL

ALG2 polyclonal antibody

Sign In for Pricing
View Details
ALG2 polyclonal antibody
orb647105-03 200 µL

ALG2 polyclonal antibody

Sign In for Pricing
View Details
ZNF407-AS1 (NM_001008234) Human Over-expression Lysate
LS400657-100ug 100 µg

ZNF407-AS1 (NM_001008234) Human Over-expression Lysate

Sign In for Pricing
View Details
HLB SPE Cartridges500mg/12ml
SPEB00HLB12500A 20 Pieces/Case:20 Pieces/ PACKS:1 PACKS/CASE

HLB SPE Cartridges500mg/12ml

Sign In for Pricing
View Details