Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR4 Peptide - C-terminal region

PLSCR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRA1

UniProt

Q9NRQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR4 Rabbit Polyclonal Antibody (orb586505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065086

Preservative

Lyophilized powder

AA Sequence

HWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome B245 (p22phox, Flavocytochome B, Cyt B) (FITC)
214778-FITC 100 µL

Cytochrome B245 (p22phox, Flavocytochome B, Cyt B) (FITC)

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin (Scgb1a1)
MBS1218817-01 0.02 mg (E-Coli)

Recombinant Rat Uteroglobin (Scgb1a1)

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin (Scgb1a1)
MBS1218817-02 0.1 mg (E-Coli)

Recombinant Rat Uteroglobin (Scgb1a1)

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin (Scgb1a1)
MBS1218817-03 0.02 mg (Yeast)

Recombinant Rat Uteroglobin (Scgb1a1)

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin (Scgb1a1)
MBS1218817-04 0.1 mg (Yeast)

Recombinant Rat Uteroglobin (Scgb1a1)

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin (Scgb1a1)
MBS1218817-05 0.02 mg (Baculovirus)

Recombinant Rat Uteroglobin (Scgb1a1)

Sign In for Pricing
View Details