Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR4 Peptide - C-terminal region

PLSCR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRA1

UniProt

Q9NRQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR4 Rabbit Polyclonal Antibody (orb586505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065086

Preservative

Lyophilized powder

AA Sequence

HWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vkorc1l1 ORF Vector (Rat) (pORF)
49512016 1.0 µg DNA

Vkorc1l1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Gm8267 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3065503 1.0 µg DNA

Gm8267 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-METAP1D Antibody Picoband®, iFluor647 Conjugate
A11898-1-iFluor647 100 µg

Anti-METAP1D Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
CD2 (3B6) : m-IgGκ BP-HRP Bundle
sc-533770 1 Kit

CD2 (3B6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Human FADD Protein, His (Fc)-Avi-tagged
FADD-885H 50 µg

Recombinant Human FADD Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Omni-probe (D-8) Alexa Fluor® 647
sc-7270 AF647 200 µg/mL

Omni-probe (D-8) Alexa Fluor® 647

Sign In for Pricing
View Details