PLSCR2 Peptide - C-terminal region
PLSCR2 Peptide - C-terminal region
Product Specifications
UniProt
Q9NRY7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLSCR2 Rabbit Polyclonal Antibody (orb326591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065092
Preservative
Lyophilized powder
AA Sequence
PVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680821-500 1x 500 µL
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
F-1801-5 5 mg
FITC Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-
Sign In for Pricing
View Details 
PKSH033350-01 10 µg
Recombinant Human C1QBP Protein (aa 74-282, His Tag)
Sign In for Pricing
View Details PKSH033350-02 50 µg
Recombinant Human C1QBP Protein (aa 74-282, His Tag)
Sign In for Pricing
View Details