Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR2 Peptide - C-terminal region

PLSCR2 Peptide - C-terminal region

Product Specifications

UniProt

Q9NRY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR2 Rabbit Polyclonal Antibody (orb326591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065092

Preservative

Lyophilized powder

AA Sequence

PVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCR Human Gene Knockout Kit (CRISPR)
KN213184BN 1 Kit

HMGCR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF405S conjugate, 0.1mg/mL
BNC041830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDX17 (N-term) Rabbit Polyclonal Antibody
AP51217PU-N 400 µL

DDX17 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF568 conjugate, 0.1mg/mL
BNC680778-100 1x 100 µL

Cytokeratin 17 (KRT17/778), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FGF4 Human Gene Knockout Kit (CRISPR)
KN417058 1 Kit

FGF4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
A 769662
SIH-490-5MG 5 mg

A 769662

Sign In for Pricing
View Details