Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR1OP2 Peptide - C-terminal region

FGFR1OP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564O1863, DKFZp586C1423, FLJ37569, HSPC123-like, WIT3.0

UniProt

Q9NVK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFR1OP2 Rabbit Polyclonal Antibody (orb586348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056448

Preservative

Lyophilized powder

AA Sequence

ANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50/ICAM-3 (Phospho-Ser518) Antibody
MBS9508580-01 0.05 mL

CD50/ICAM-3 (Phospho-Ser518) Antibody

Sign In for Pricing
View Details
CD50/ICAM-3 (Phospho-Ser518) Antibody
MBS9508580-02 0.1 mL

CD50/ICAM-3 (Phospho-Ser518) Antibody

Sign In for Pricing
View Details
CD50/ICAM-3 (Phospho-Ser518) Antibody
MBS9508580-03 5x 0.1 mL

CD50/ICAM-3 (Phospho-Ser518) Antibody

Sign In for Pricing
View Details
Sodium Iodide Symporter Rabbit pAb
orb2718208-01 50 µL

Sodium Iodide Symporter Rabbit pAb

Sign In for Pricing
View Details
Sodium Iodide Symporter Rabbit pAb
orb2718208-02 100 µL

Sodium Iodide Symporter Rabbit pAb

Sign In for Pricing
View Details
Recombinant Mouse Gastrin (GT)
RPU41585-01 50 µg

Recombinant Mouse Gastrin (GT)

Sign In for Pricing
View Details