Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR1OP2 Peptide - C-terminal region

FGFR1OP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564O1863, DKFZp586C1423, FLJ37569, HSPC123-like, WIT3.0

UniProt

Q9NVK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFR1OP2 Rabbit Polyclonal Antibody (orb586348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056448

Preservative

Lyophilized powder

AA Sequence

ANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit
MBS9909873-01 48 Well

Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit
MBS9909873-02 96 Well

Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit
MBS9909873-03 5x 96 Well

Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit
MBS9909873-04 10x 96 Well

Canine Serine/Threonine-Protein Phosphatase PP1-Beta Catalytic Subunit (PPP1CB) ELISA Kit

Sign In for Pricing
View Details
IDDM17 3'UTR GFP Stable Cell Line
TU060420 1.0 mL

IDDM17 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VAMP3 AAV Vector (Human) (CMV)
49417102 1 µg

VAMP3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details