Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADPRHL2 Peptide - C-terminal region

ADPRHL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARH3, FLJ20446

UniProt

Q9NX46

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADPRHL2 Rabbit Polyclonal Antibody (orb586525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060295

Preservative

Lyophilized powder

AA Sequence

SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA1 Human Gene Knockout Kit (CRISPR)
KN418871 1 Kit

PNPLA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IYD activation kit by CRISPRa
GA118056 1 Kit

Human IYD activation kit by CRISPRa

Sign In for Pricing
View Details
SLC35B1 (NM_005827) Human Over-expression Lysate
LC401770 20 µg

SLC35B1 (NM_005827) Human Over-expression Lysate

Sign In for Pricing
View Details
O-Desethyl Azilsartan-d4
TRC-D289257-10MG 10 mg

O-Desethyl Azilsartan-d4

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105UM1-02 100 µg

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details