Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADPRHL2 Peptide - C-terminal region

ADPRHL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARH3, FLJ20446

UniProt

Q9NX46

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADPRHL2 Rabbit Polyclonal Antibody (orb586525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060295

Preservative

Lyophilized powder

AA Sequence

SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS505295 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Mouse Th activation kit by CRISPRa
GA204332 1 Kit

Mouse Th activation kit by CRISPRa

Sign In for Pricing
View Details
IPO11 (NM_016338) Human Recombinant Protein
TP307519M 100 µg

IPO11 (NM_016338) Human Recombinant Protein

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Human Gene Knockout Kit (CRISPR)
KN416029 1 Kit

Myeloperoxidase (MPO) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Amino-L-trans-proline
TRC-A593885-50MG 50 mg

4-Amino-L-trans-proline

Sign In for Pricing
View Details
Atholate™, protein hydrolysate, 2.5 kg
0134-2.5 2.5 Kg

Atholate™, protein hydrolysate, 2.5 kg

Sign In for Pricing
View Details