Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R16 Peptide - C-terminal region

TAS2R16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T2R16

UniProt

Q9NYV7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R16 Rabbit Polyclonal Antibody (orb586458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058641

Preservative

Lyophilized powder

AA Sequence

TILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2B (acetyl K20) Recombinant Rabbit Monoclonal Antibody [PS01-46]
HA721285 100 µL

Histone H2B (acetyl K20) Recombinant Rabbit Monoclonal Antibody [PS01-46]

Sign In for Pricing
View Details
Sancycline Hydrochloride
TRC-S111500-50MG 50 mg

Sancycline Hydrochloride

Sign In for Pricing
View Details
(1S,2S)-2-Aminocyclopentanecarboxylic Acid Hydrate
TRC-A938130-10MG 10 mg

(1S,2S)-2-Aminocyclopentanecarboxylic Acid Hydrate

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (N/A), CF594 conjugate, 0.1mg/mL
BNC941851-500 1x 500 µL

P53 Tumor Suppressor Protein (N/A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL
BNC042988-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USP24 Recombinant Rabbit Monoclonal Antibody [JE56-50]
HA720022 100 µL

USP24 Recombinant Rabbit Monoclonal Antibody [JE56-50]

Sign In for Pricing
View Details