TMOD4 Peptide - middle region
TMOD4 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp779I0852, SK-TMOD
UniProt
Q9NZQ9
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMOD4 Rabbit Polyclonal Antibody (orb586460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_037485
Preservative
Lyophilized powder
AA Sequence
CNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNI
More Discoveries
Explore Other Products
Browse additional items from our catalog
43894154 3x 1.0 µg DNA
SLC16A12 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details MBS6334466-01 0.2 mL
PKNOX2, ID (PKNOX2, PREP2, Homeobox protein PKNOX2, Homeobox protein PREP-2, PBX/knotted homeobox 2) (APC)
Sign In for Pricing
View Details 
MBS6334466-02 5x 0.2 mL
PKNOX2, ID (PKNOX2, PREP2, Homeobox protein PKNOX2, Homeobox protein PREP-2, PBX/knotted homeobox 2) (APC)
Sign In for Pricing
View Details 
VD12N648 1 Each
Rabbit Anti-Canine Syntenin-2 (SDCBP2) Polyclonal Antibody
Sign In for Pricing
View Details