Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD4 Peptide - middle region

TMOD4 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp779I0852, SK-TMOD

UniProt

Q9NZQ9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMOD4 Rabbit Polyclonal Antibody (orb586460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037485

Preservative

Lyophilized powder

AA Sequence

CNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNI

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11FIP2 siRNA Oligos set (Human)
38294171 3x 5 nmol

RAB11FIP2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Escherichia coli cobS Protein (aa 1-247) (strain ED1a)
VAng-Lsx02218-inquire Inquire

Recombinant Escherichia coli cobS Protein (aa 1-247) (strain ED1a)

Sign In for Pricing
View Details
Recombinant Escherichia coli Chain length determinant protein (wzzB), partial
MBS1038026-01 1 mg (E-Coli)

Recombinant Escherichia coli Chain length determinant protein (wzzB), partial

Sign In for Pricing
View Details
Recombinant Escherichia coli Chain length determinant protein (wzzB), partial
MBS1038026-02 1 mg (Yeast)

Recombinant Escherichia coli Chain length determinant protein (wzzB), partial

Sign In for Pricing
View Details
Genesig Real-Time PCR detection kit for Mycoplasma pneumoniae, Advanced
349305 1 Kit

Genesig Real-Time PCR detection kit for Mycoplasma pneumoniae, Advanced

Sign In for Pricing
View Details
TAGLN Antibody
E96760 100 µL

TAGLN Antibody

Sign In for Pricing
View Details