Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRIM1 Peptide - C-terminal region

CRIM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC138194, S52

UniProt

Q9NZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRIM1 Rabbit Polyclonal Antibody (orb586145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057525

Preservative

Lyophilized powder

AA Sequence

NQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDSSQRMLRIAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

URB754
TRC-U822000-5MG 5 mg

URB754

Sign In for Pricing
View Details
GGT1 Goat Polyclonal Antibody
AP32725PU-N 100 µg

GGT1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
F4/80 Recombinant Chimeric Antibody Antibody
HA601538 100 µL

F4/80 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Rabbit Anti-PHA-E Antibody
HAL-1802-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Anti-PHA-E Antibody

Sign In for Pricing
View Details
CTGF Recombinant Rabbit monoclonal Antibody
HA751575 100 µL

CTGF Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PAX6 Human Knockdown Lysate
LY300262 100 µg

PAX6 Human Knockdown Lysate

Sign In for Pricing
View Details