Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRIM1 Peptide - C-terminal region

CRIM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC138194, S52

UniProt

Q9NZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRIM1 Rabbit Polyclonal Antibody (orb586145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057525

Preservative

Lyophilized powder

AA Sequence

NQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDSSQRMLRIAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPRL1 (FPR2) (2nd extracell. loop) Rabbit Polyclonal Antibody
AP32357PU-N 100 µg

FPRL1 (FPR2) (2nd extracell. loop) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®680 Maleimide
#92029 1x 1 µmol

CF®680 Maleimide

Sign In for Pricing
View Details
GRAF (ARHGAP26) (NM_015071) Human Recombinant Protein
TP313996L 1 mg

GRAF (ARHGAP26) (NM_015071) Human Recombinant Protein

Sign In for Pricing
View Details
HBXIP (LAMTOR5) (NM_006402) Human Over-expression Lysate
LC401923 20 µg

HBXIP (LAMTOR5) (NM_006402) Human Over-expression Lysate

Sign In for Pricing
View Details
C10orf30 (BEND7) Human Gene Knockout Kit (CRISPR)
KN415807 1 Kit

C10orf30 (BEND7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR4F15 (N-term) Rabbit Polyclonal Antibody
AP53052PU-N 400 µL

OR4F15 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details