Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A10 Peptide - middle region

SLC25A10 Peptide - middle region

Product Specifications

Product Name Alternative

DIC

UniProt

Q9UBX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A10 Rabbit Polyclonal Antibody (orb586455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036272

Preservative

Lyophilized powder

AA Sequence

PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA8 (Interferon alpha-8, IFN-alpha-8, Interferon alpha-B, LeIF B, Interferon alpha-B2, IFNA8) (AP) discontinued
302497-AP 200 µL

IFNA8 (Interferon alpha-8, IFN-alpha-8, Interferon alpha-B, LeIF B, Interferon alpha-B2, IFNA8) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ATP2C1 Antibody
NBP1-88887-25ul 25 µL

Rabbit Polyclonal ATP2C1 Antibody

Sign In for Pricing
View Details
TFDP3 Protein Lysate (Human) with C-Ha Tag
46569031 100 µg

TFDP3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CLDN1 Recombinant Rabbit mAb, FITC conjugated
orb3163501 100 µL

CLDN1 Recombinant Rabbit mAb, FITC conjugated

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica rbfA Protein (aa 1-136) (strain 8081)
VAng-Wyb1732-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica rbfA Protein (aa 1-136) (strain 8081)

Sign In for Pricing
View Details
Phospho-NMDAR1 (Ser896) Rabbit pAb, IRDye 800CW conjugated
orb2827859 100 µL

Phospho-NMDAR1 (Ser896) Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details