Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A10 Peptide - middle region

SLC25A10 Peptide - middle region

Product Specifications

Product Name Alternative

DIC

UniProt

Q9UBX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A10 Rabbit Polyclonal Antibody (orb586455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036272

Preservative

Lyophilized powder

AA Sequence

PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPSA10940-10UG - Human PDGF AA HOMODIMER Protein
OPSA10940-10UG 10 µg

OPSA10940-10UG - Human PDGF AA HOMODIMER Protein

Sign In for Pricing
View Details
MTMR15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1363606 1.0 µg DNA

MTMR15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
NDUFAF1 Antibody
orb679814 100 µL

NDUFAF1 Antibody

Sign In for Pricing
View Details
Prss16 Rat shRNA Plasmid (Locus ID 364719)
TL703225 1 Kit

Prss16 Rat shRNA Plasmid (Locus ID 364719)

Sign In for Pricing
View Details
Anti-FCER1G Antibody Picoband® Fluoro647 Conjugated
A06420-Fluoro647 100 µg/Vial

Anti-FCER1G Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
ZNF81 (NM_007137) Human Tagged ORF Clone
RG212519 10 µg

ZNF81 (NM_007137) Human Tagged ORF Clone

Sign In for Pricing
View Details