Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLVCR2 Peptide - C-terminal region

FLVCR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf58, CCT, FLJ20371, FLVCRL14q, EPV, PVHH, MFSD7C

UniProt

Q9UPI3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLVCR2 Rabbit Polyclonal Antibody (orb586475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060261

Preservative

Lyophilized powder

AA Sequence

TLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYKETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histo-Clear II
NAT1336 5 US Gallon - 18.9 L

Histo-Clear II

Sign In for Pricing
View Details
Mouse Fbln1 activation kit by CRISPRa
GA201364 1 Kit

Mouse Fbln1 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193C-01 50 Tests

FITC Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
FITC Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193C-02 100 Tests

FITC Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
FITC Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193C-03 2x 100 Tests

FITC Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
MEF2C pThr20 Rabbit Polyclonal Antibody
AP12776PU-N 400 µL

MEF2C pThr20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details