Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL1 Peptide - N-terminal region

PPIL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGI-124, CYPL1, MGC678, PPIase, hCyPX

UniProt

Q9Y3C6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIL1 Rabbit Polyclonal Antibody (orb586420) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057143

Preservative

Lyophilized powder

AA Sequence

YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Amino-7-naphthalenesulfonic Acid
TRC-A618353-25G 25 g

1-Amino-7-naphthalenesulfonic Acid

Sign In for Pricing
View Details
Synapsin I (SYN1) Rabbit Polyclonal Antibody
AP02760PU-S 50 µL

Synapsin I (SYN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Hydroxychrysene
TRC-H905335-1MG 1 mg

1-Hydroxychrysene

Sign In for Pricing
View Details
RIPK5 (DSTYK) (NM_015375) Human Over-expression Lysate
LY402430 100 µg

RIPK5 (DSTYK) (NM_015375) Human Over-expression Lysate

Sign In for Pricing
View Details
Glycidol (~90%)
TRC-G615703-1G 1 g

Glycidol (~90%)

Sign In for Pricing
View Details
Human PEX26 activation kit by CRISPRa
GA110872 1 Kit

Human PEX26 activation kit by CRISPRa

Sign In for Pricing
View Details