Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL1 Peptide - N-terminal region

PPIL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGI-124, CYPL1, MGC678, PPIase, hCyPX

UniProt

Q9Y3C6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIL1 Rabbit Polyclonal Antibody (orb586420) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057143

Preservative

Lyophilized powder

AA Sequence

YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTM1 Rabbit Polyclonal Antibody
TA371099 100 µL

CMTM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLX1 (SLX1A) Human Gene Knockout Kit (CRISPR)
KN400806 1 Kit

SLX1 (SLX1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL
BNC881683-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS643235 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS710984 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
THOP1 Polyclonal Antibody
E-AB-18748-01 20 µL

THOP1 Polyclonal Antibody

Sign In for Pricing
View Details