Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRFAP1 Peptide - C-terminal region

MRFAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAM14, PGR1

UniProt

Q9Y605

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRFAP1 Rabbit Polyclonal Antibody (orb586232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150638

Preservative

Lyophilized powder

AA Sequence

KTQVEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-1 beta ELISA Kit
orb1216561-01 1 set (1 x capture antibody)

Mouse IL-1 beta ELISA Kit

Sign In for Pricing
View Details
Mouse IL-1 beta ELISA Kit
orb1216561-02 1 set (2 x capture antibody)

Mouse IL-1 beta ELISA Kit

Sign In for Pricing
View Details
Horse Pepsin ELISA Kit
MBS023763-01 48 Well

Horse Pepsin ELISA Kit

Sign In for Pricing
View Details
Horse Pepsin ELISA Kit
MBS023763-02 96 Well

Horse Pepsin ELISA Kit

Sign In for Pricing
View Details
Horse Pepsin ELISA Kit
MBS023763-03 5x 96 Well

Horse Pepsin ELISA Kit

Sign In for Pricing
View Details
Horse Pepsin ELISA Kit
MBS023763-04 10x 96 Well

Horse Pepsin ELISA Kit

Sign In for Pricing
View Details