Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spa17 Peptide - middle region

Spa17 Peptide - middle region

Product Specifications

Product Name Alternative

Sp17

UniProt

Q9Z1K2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Spa17 Rabbit Polyclonal Antibody (orb325885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445934

Preservative

Lyophilized powder

AA Sequence

AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Sonnei ipgF Protein (aa 18-152)
VAng-Lsx09794-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei ipgF Protein (aa 18-152)

Sign In for Pricing
View Details
Rabbit Anti-Nucleoside phosphorylase antibody
SL11739R-01 50 µL

Rabbit Anti-Nucleoside phosphorylase antibody

Sign In for Pricing
View Details
Rabbit Anti-Nucleoside phosphorylase antibody
SL11739R-02 100 µL

Rabbit Anti-Nucleoside phosphorylase antibody

Sign In for Pricing
View Details
Gemin4 (E-8) Alexa Fluor® 790
sc-365424 AF790 200 µg/mL

Gemin4 (E-8) Alexa Fluor® 790

Sign In for Pricing
View Details
Mouse Monoclonal Varicella Zoster Virus Glycoprotein E Antibody (15) [DyLight 405]
NBP3-26891V 0.1 mL

Mouse Monoclonal Varicella Zoster Virus Glycoprotein E Antibody (15) [DyLight 405]

Sign In for Pricing
View Details
Hepatitis B Virus Surface Antigen Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2327R-APC-Cy5.5 100 µL

Hepatitis B Virus Surface Antigen Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details