Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41L4B Peptide - middle region

EPB41L4B Peptide - middle region

Product Specifications

Product Name Alternative

CG1, DKFZp761N1814, EHM2, FLJ21596

UniProt

Q9H329

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPB41L4B Rabbit Polyclonal Antibody (orb586286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060894

Preservative

Lyophilized powder

AA Sequence

AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-221-5p miRNA Agomir
abx883488-01 5 nmol

Mouse mmu-miR-221-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-221-5p miRNA Agomir
abx883488-02 10 nmol

Mouse mmu-miR-221-5p miRNA Agomir

Sign In for Pricing
View Details
Obfc1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6585103 1.0 µg DNA

Obfc1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CRSP130 Polyclonal Antibody
MBS9243238-01 0.1 mL

CRSP130 Polyclonal Antibody

Sign In for Pricing
View Details
CRSP130 Polyclonal Antibody
MBS9243238-02 5x 0.1 mL

CRSP130 Polyclonal Antibody

Sign In for Pricing
View Details
PD 153035
TRC-P218343-50MG 50 mg

PD 153035

Sign In for Pricing
View Details