EPB41L4B Peptide - middle region
EPB41L4B Peptide - middle region
Product Specifications
Product Name Alternative
CG1, DKFZp761N1814, EHM2, FLJ21596
UniProt
Q9H329
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EPB41L4B Rabbit Polyclonal Antibody (orb586286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060894
Preservative
Lyophilized powder
AA Sequence
AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1387417 Inquire
Recombinant Dictyostelium discoideum Probable inactive serine/threonine-protein kinase slob1 (slob1), partial
Sign In for Pricing
View Details MBS6405378-01 0.1 mL
ACTR3 (Actin-related Protein 3, Actin-like Protein 3, ARP3) (Biotin)
Sign In for Pricing
View Details MBS6405378-02 5x 0.1 mL
ACTR3 (Actin-related Protein 3, Actin-like Protein 3, ARP3) (Biotin)
Sign In for Pricing
View Details