Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2 Peptide - C-terminal region

FOLR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BETA-HFR, FBP/PL-1, FR-BETA, FR-P3

UniProt

P14207

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOLR2 Rabbit Polyclonal Antibody (orb586381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000794

Preservative

Lyophilized powder

AA Sequence

LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atad1 Mouse Monoclonal Antibody [Clone ID: N125/10]
75-157 100 µL

Atad1 Mouse Monoclonal Antibody [Clone ID: N125/10]

Sign In for Pricing
View Details
Human GPR73B (PROKR2) activation kit by CRISPRa
GA115057 1 Kit

Human GPR73B (PROKR2) activation kit by CRISPRa

Sign In for Pricing
View Details
CD262 / DR5 (DR5/3381), CF647 conjugate, 0.1mg/mL
BNC473381-100 1x 100 µL

CD262 / DR5 (DR5/3381), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat NGAL (NeutrophilGelatinase Associated Lipocalin) ELISA Kit
E-EL-R3055-01 24 Tests

Rat NGAL (NeutrophilGelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Rat NGAL (NeutrophilGelatinase Associated Lipocalin) ELISA Kit
E-EL-R3055-02 48 Tests

Rat NGAL (NeutrophilGelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Rat NGAL (NeutrophilGelatinase Associated Lipocalin) ELISA Kit
E-EL-R3055-03 96 Tests

Rat NGAL (NeutrophilGelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details